PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30054.m000809
Common NameRCOM_1278200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB
Protein Properties Length: 322aa    MW: 36225.9 Da    PI: 6.7318
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30054.m000809genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.4e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lvd+++++G g+W++ ++  g++R++k+c++rw +yl
    30054.m000809 15 KGPWTPEEDEKLVDYINKHGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.33e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eE+ ++v+++  lG++ W++Ia +++ gRt++++k++w+++
    30054.m000809  68 RGKFTDEEERIIVNLHSVLGNK-WSRIAGHLP-GRTDNEIKNFWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.8391062IPR017930Myb domain
SuperFamilySSF466893.0E-3212109IPR009057Homeodomain-like
SMARTSM007172.7E-161464IPR001005SANT/Myb domain
PfamPF002493.7E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-261669IPR009057Homeodomain-like
CDDcd001671.53E-121762No hitNo description
PROSITE profilePS5129427.28163117IPR017930Myb domain
SMARTSM007179.9E-1667115IPR001005SANT/Myb domain
PfamPF002495.3E-1568112IPR001005SANT/Myb domain
CDDcd001672.34E-1170113No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRPPCCFAE DNLKKGPWTP EEDEKLVDYI NKHGHGSWRL LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FTDEEERIIV NLHSVLGNKW SRIAGHLPGR TDNEIKNFWN THIRKKLLQM  120
GIDPNTHKPR TDLNHLLSLS QLLGGLQFGS LTSAAPWHNI LKLQADATHL AKTQVLQNLL  180
QIINTSTLTN TRNISHIGPQ NRNPVEELSN KAISFNTNPL ACIEGGLGQG VSNMENNSLS  240
SCYDIQTEIT LPELISTSSS PETSVFNQVE SNPDYFDGWP TLTVFESLDN LMDNETSCSF  300
WKDILDSTSF LHTPAEAPTL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-32121174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579936.10.0PREDICTED: transcription factor MYB39, partial
TrEMBLB9SNT70.0B9SNT7_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0003s09300.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.12e-84myb domain protein 107